Huayue Pharmaceutical Co., Ltd.
Qualité sincère, professionnelle et bonne
Select Language
English
French
German
Spanish
Portuguese
Dutch
Japanese
Maison Produits D'autres Drogues De Somatotropin De Peptide

Sermorelin

Parcourir les catégories
contacto
Ms. Li
27F WT Center,6 HK M.Rd.,Qingdao China
Je suis causerie en ligne maintenant

Sermorelin

Conditions de paiement et expédition:
Quantité de commande min: 1 kit
Détails d'emballage: standard
Délai de livraison: dans une semaine
Conditions de paiement: Union de Wester, Moneygarms
Capacité d'approvisionnement: 100000mg/month
description de
Numéro de catalogue L648976
Certifié de niveau CLHP certifiée
Spectre de masse certifié
Taille d'unité 2 mg/vial
Quantité d'unité 1 fiole
Poids total mg 2
CAS NON. 86168-78-7
Synonymes Acétate de Sermorelin
Formule moléculaire C149H246N44O42S
Poids moléculaire 3357,88
Ordre H-Tyr-Aile du Nez-Asp-Aile du Nez-Ile-Phe-Thr-Asn-Ser-Tyr-Arg Lys-Val-Leu-Gly-Gln-Leu-Ser-Aile du nez-Arg-Lys-Leu Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Aspect Poudre blanche
Pureté >98% (CLHP)
Identité (ESI-MS) 3357.88±4.0
Source Synthèse chimique
Endotoxines bactériennes < 5EU/mg
Examinez le paramètre Standard
Solubilité Soluble en eau ou acide acétique de 1%
Stockage SERMORELIN lyophilisé bien que stable à la température ambiante pendant 3 semaines, devrait être stocké a desséché au-dessous de -18°C. lors de la reconstitution FST devrait être stocké à 4°C entre 2-7 jours et pour une utilisation future au-dessous de -18°C.
Rapports :
M120630-L648976 98,21% Milliseconde CLHP
M121006-L648976 98,71% Milliseconde CLHP
Sermorelin, parfois appelé le GRF 1-29 NH2 avec l'ordre YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, est un polypeptide acide aminé du synthétique 29 amidés qui correspond au segment d'aminé-terminal de l'hormone de hormone-libération de croissance humaine naturelle (GHRH ou GRF) se composant de 44 résidus d'acide aminé. Il est employé comme essai pour la sécrétion d'hormone de croissance et employé souvent intensivement dans la thérapie anti-vieillissement en même temps que la testostérone dans les hommes.
 

 

Les produits chauds de vendeur énumèrent : :

Kigtropin 10iu

Jintropin 10iu

HGH 10iu

IGF-1LR3 100mcg

DES 1mg d'IGF

CJC1295 sans DAC 2mg

CJC1295 avec DAC 2mg

GHRP-2 5mg

GHRP-6 5mg

HCG 5000 unités internationales

Hexarelin 2mg

HGH Frag 176/191 2mg

Ipamorelin 2mg

Melanotan I 10mg

MGF 2mg

Cheville-MGF 2mg

PT-141 10mg

Sermorelin 2mg

Thymosin β4 2mg

OEB 3000 unités internationales

Tesamorelin 2mg

 

 

 

contacto
Ms. Li
  • 86-010-85668888-218
  • 27F WT Center,6 HK M.Rd.,Qingdao China
à Partir De:
Entrez votre Email ID s'il vous plaît.
Envoyez votre demande directement à nous
(76/3000)